SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP43084_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP43084_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

WWP1 Antibody - N-terminal region : HRP (ARP43084_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-WWP1 (ARP43084_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human WWP1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT
Concentration0.5 mg/ml
Blocking PeptideFor anti-WWP1 (ARP43084_P050-HRP) antibody is Catalog # AAP43084 (Previous Catalog # AAPP25059)
Sample Type Confirmation

WWP1 is supported by BioGPS gene expression data to be expressed in HEK293T

ReferenceHeidecker,G., (2007) J. Virol. 81 (18), 9769-9777
Gene SymbolWWP1
Gene Full NameWW domain containing E3 ubiquitin protein ligase 1
Alias SymbolsAIP5, Tiul1, hSDRP1
NCBI Gene Id11059
Protein NameNEDD4-like E3 ubiquitin-protein ligase WWP1
Description of TargetWW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. WWP1 is a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. WWP1 belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes.WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ9H0M0
Protein Accession #NP_008944
Nucleotide Accession #NM_007013
Protein Size (# AA)922
Molecular Weight105kDa
Protein InteractionsSMAD3; FBXL18; WWP1; TRAF4; FAM189A2; UBE2L3; UBC; PTCH1; SMAD6; NOTCH1; EZH2; YWHAQ; CPSF6; TRAF6; LAPTM5; SMAD5; HSP90AA1; FBXL15; H2AFY2; PHF20L1; RNF11; ASH2L; PRKAA2; ATN1; LNX1; TP63; PTPN14; ERBB4; NFE2; SMAD7; SMAD4; SMAD2; SMAD1; RUNX2; Axin1; ga
  1. What is the species homology for "WWP1 Antibody - N-terminal region : HRP (ARP43084_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "WWP1 Antibody - N-terminal region : HRP (ARP43084_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "WWP1 Antibody - N-terminal region : HRP (ARP43084_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "WWP1 Antibody - N-terminal region : HRP (ARP43084_P050-HRP)"?

    This target may also be called "AIP5, Tiul1, hSDRP1" in publications.

  5. What is the shipping cost for "WWP1 Antibody - N-terminal region : HRP (ARP43084_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "WWP1 Antibody - N-terminal region : HRP (ARP43084_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "WWP1 Antibody - N-terminal region : HRP (ARP43084_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "105kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "WWP1 Antibody - N-terminal region : HRP (ARP43084_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "WWP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "WWP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "WWP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "WWP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "WWP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "WWP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:WWP1 Antibody - N-terminal region : HRP (ARP43084_P050-HRP)
Your Rating
We found other products you might like!