Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

WWP1 antibody - N-terminal region (ARP43084_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP43084_P050-FITC Conjugated

ARP43084_P050-HRP Conjugated

ARP43084_P050-Biotin Conjugated

Gene Symbol:
WWP1
NCBI Gene Id:
11059
Official Gene Full Name:
WW domain containing E3 ubiquitin protein ligase 1
Protein Name:
NEDD4-like E3 ubiquitin-protein ligase WWP1
Swissprot Id:
Q9H0M0
Protein Accession #:
NP_008944
Nucleotide Accession #:
NM_007013
Alias Symbols:
AIP5, DKFZp434D2111, Tiul1, hSDRP1
Replacement Item:
This antibody may replace item sc-100679 from Santa Cruz Biotechnology.
Description of Target:
WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. WWP1 is a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. WWP1 belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes.WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
922
Molecular Weight:
105kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express WWP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express WWP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human WWP1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-WWP1 (ARP43084_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SMAD3; FBXL18; WWP1; TRAF4; FAM189A2; UBE2L3; UBC; PTCH1; SMAD6; NOTCH1; EZH2; YWHAQ; CPSF6; TRAF6; LAPTM5; SMAD5; HSP90AA1; FBXL15; H2AFY2; PHF20L1; RNF11; ASH2L; PRKAA2; ATN1; LNX1; TP63; PTPN14; ERBB4; NFE2; SMAD7; SMAD4; SMAD2; SMAD1; RUNX2; Axin1; ga
Blocking Peptide:
For anti-WWP1 (ARP43084_P050) antibody is Catalog # AAP43084 (Previous Catalog # AAPP25059)
Datasheets/Manuals:
Printable datasheet for anti-WWP1 (ARP43084_P050) antibody
Sample Type Confirmation:

WWP1 is supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Heidecker,G., (2007) J. Virol. 81 (18), 9769-9777

Tell us what you think about this item!

Write A Review
    Please, wait...