Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP38517_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38517_P050-FITC Conjugated

ARP38517_P050-HRP Conjugated

ARP38517_P050-Biotin Conjugated

WDR39 Antibody - C-terminal region (ARP38517_P050)

Catalog#: ARP38517_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-374498 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human WDR39
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 86%
Complete computational species homology data Anti-WDR39 (ARP38517_P050)
Peptide Sequence Synthetic peptide located within the following region: HSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CIAO1 (ARP38517_P050) antibody is Catalog # AAP38517 (Previous Catalog # AAPP20708)
Datasheets/Manuals Printable datasheet for anti-CIAO1 (ARP38517_P050) antibody
Sample Type Confirmation

CIAO1 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Johnstone,R.W., et al., (1998) J. Biol. Chem. 273 (18), 10880-10887
Gene Symbol CIAO1
Official Gene Full Name Cytosolic iron-sulfur protein assembly 1
Alias Symbols CIA1, WDR39
NCBI Gene Id 9391
Protein Name Probable cytosolic iron-sulfur protein assembly protein CIAO1
Description of Target WDR39 is a member of the WD40 family of proteins. WDR39 specifically interacts with WT1 both in vitro and in vivo. This interaction results in a decrease in transcriptional activation mediated by WT1. WDR39 does not inhibit binding of WT1 to its consensus nucleotide sequence and does not affect the repression activity of WT1. Thus, WDR39 appears to specifically modulate the transactivation activity of WT1 and may function to regulate the physiological functions of WT1 in cell growth and differentiation.
Swissprot Id O76071
Protein Accession # NP_004795
Nucleotide Accession # NM_004804
Protein Size (# AA) 339
Molecular Weight 38kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express WDR39.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express WDR39.
Protein Interactions FAM96B; SF1; MEOX1; FAM96A; MMS19; FMNL2; TOE1; DPP9; FMNL3; CTU1; PPIL4; MAK16; WDR75; NSRP1; EEPD1; WDR61; CDC73; UPF3B; NARFL; YAE1D1; TYW1; ELP2; ELP3; UCKL1; CDKAL1; DPP8; ELP6; PAF1; PLEKHA5; PHAX; RTEL1; ELP4; POLA2; ELP5; WDR43; ERP29; GLRX3; CTR9
  1. What is the species homology for "WDR39 Antibody - C-terminal region (ARP38517_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "WDR39 Antibody - C-terminal region (ARP38517_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "WDR39 Antibody - C-terminal region (ARP38517_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "WDR39 Antibody - C-terminal region (ARP38517_P050)"?

    This target may also be called "CIA1, WDR39" in publications.

  5. What is the shipping cost for "WDR39 Antibody - C-terminal region (ARP38517_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "WDR39 Antibody - C-terminal region (ARP38517_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "WDR39 Antibody - C-terminal region (ARP38517_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "WDR39 Antibody - C-terminal region (ARP38517_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CIAO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CIAO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CIAO1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CIAO1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CIAO1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CIAO1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:WDR39 Antibody - C-terminal region (ARP38517_P050)
Your Rating
We found other products you might like!