Search Antibody, Protein, and ELISA Kit Solutions

WDR39 Antibody - C-terminal region (ARP38517_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38517_P050-FITC Conjugated

ARP38517_P050-HRP Conjugated

ARP38517_P050-Biotin Conjugated

Gene Symbol:
CIAO1
Official Gene Full Name:
Cytosolic iron-sulfur protein assembly 1
NCBI Gene Id:
9391
Protein Name:
Probable cytosolic iron-sulfur protein assembly protein CIAO1
Swissprot Id:
O76071
Protein Accession #:
NP_004795
Nucleotide Accession #:
NM_004804
Alias Symbols:
CIA1, WDR39
Replacement Item:
This antibody may replace item sc-374498 from Santa Cruz Biotechnology.
Description of Target:
WDR39 is a member of the WD40 family of proteins. WDR39 specifically interacts with WT1 both in vitro and in vivo. This interaction results in a decrease in transcriptional activation mediated by WT1. WDR39 does not inhibit binding of WT1 to its consensus nucleotide sequence and does not affect the repression activity of WT1. Thus, WDR39 appears to specifically modulate the transactivation activity of WT1 and may function to regulate the physiological functions of WT1 in cell growth and differentiation.
Protein Size (# AA):
339
Molecular Weight:
38kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express WDR39.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express WDR39.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human WDR39
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 86%
Complete computational species homology data:
Anti-WDR39 (ARP38517_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FAM96B; SF1; MEOX1; FAM96A; MMS19; FMNL2; TOE1; DPP9; FMNL3; CTU1; PPIL4; MAK16; WDR75; NSRP1; EEPD1; WDR61; CDC73; UPF3B; NARFL; YAE1D1; TYW1; ELP2; ELP3; UCKL1; CDKAL1; DPP8; ELP6; PAF1; PLEKHA5; PHAX; RTEL1; ELP4; POLA2; ELP5; WDR43; ERP29; GLRX3; CTR9
Blocking Peptide:
For anti-CIAO1 (ARP38517_P050) antibody is Catalog # AAP38517 (Previous Catalog # AAPP20708)
Datasheets/Manuals:
Printable datasheet for anti-CIAO1 (ARP38517_P050) antibody
Sample Type Confirmation:

CIAO1 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Johnstone,R.W., et al., (1998) J. Biol. Chem. 273 (18), 10880-10887

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...