CIAO1 Antibody - middle region (ARP34400_P050)

Catalog#: ARP34400_P050

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-374498 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CIAO1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%
• Peptide Sequence: Synthetic peptide located within the following region: SVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGH
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-CIAO1 (ARP34400_P050) antibody is Catalog # AAP34400 (Previous Catalog # AAPY00302)
• Sample Type Confirmation:

  CIAO1 is supported by BioGPS gene expression data to be expressed in 721_B, MCF7

• Target Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
• Gene Symbol: CIAO1
• Official Gene Full Name: Cytosolic iron-sulfur protein assembly 1
• Alias Symbols: CIA1, WDR39
• NCBI Gene Id: 9391
• Protein Name: Probable cytosolic iron-sulfur protein assembly protein CIAO1
• Description of Target: CIAO1 belongs to the WD repeat CIA1 family. It seems to specifically modulate the transactivation activity of WT1.
• Swissprot Id: O76071
• Protein Accession #: NP_004795
• Nucleotide Accession #: NM_004804
• Protein Size (# AA): 339
• Molecular Weight: 38kDa
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express CIAO1.
• Protein Interactions: FAM96B; SF1; MEOX1; FAM96A; MMS19; FMNL2; TOE1; DPP9; FMNL3; CTU1; PPIL4; MAK16; WDR75; NSRP1; EEPD1; WDR61; CDC73; UPF3B; NARFL; YAE1D1; TYW1; ELP2; ELP3; UCKL1; CDKAL1; DPP8; ELP6; PAF1; PLEKHA5; PHAX; RTEL1; ELP4; POLA2; ELP5; WDR43; ERP29; GLRX3; CTR9

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: CIAO1 antibody tested with Human 721_B_Lymphoblast (ARP34400_P050)

Product Protocol: Rabbit Anti-CIAO1 Antibody (ARP34400_P050) in Human Lung Tissue using Immunohistochemistry