Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CIAO1 antibody - middle region (ARP34400_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP34400_P050-FITC Conjugated

ARP34400_P050-HRP Conjugated

ARP34400_P050-Biotin Conjugated

Gene Symbol:
CIAO1
NCBI Gene Id:
9391
Official Gene Full Name:
Cytosolic iron-sulfur protein assembly 1
Protein Name:
Probable cytosolic iron-sulfur protein assembly protein CIAO1
Swissprot Id:
O76071
Protein Accession #:
NP_004795
Nucleotide Accession #:
NM_004804
Alias Symbols:
CIA1, WDR39
Replacement Item:
This antibody may replace item sc-374498 from Santa Cruz Biotechnology.
Description of Target:
CIAO1 belongs to the WD repeat CIA1 family. It seems to specifically modulate the transactivation activity of WT1.
Protein Size (# AA):
339
Molecular Weight:
38kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CIAO1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CIAO1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CIAO1
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%
Complete computational species homology data:
Anti-CIAO1 (ARP34400_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FAM96B; SF1; MEOX1; FAM96A; MMS19; FMNL2; TOE1; DPP9; FMNL3; CTU1; PPIL4; MAK16; WDR75; NSRP1; EEPD1; WDR61; CDC73; UPF3B; NARFL; YAE1D1; TYW1; ELP2; ELP3; UCKL1; CDKAL1; DPP8; ELP6; PAF1; PLEKHA5; PHAX; RTEL1; ELP4; POLA2; ELP5; WDR43; ERP29; GLRX3; CTR9
Blocking Peptide:
For anti-CIAO1 (ARP34400_P050) antibody is Catalog # AAP34400 (Previous Catalog # AAPY00302)
Datasheets/Manuals:
Printable datasheet for anti-CIAO1 (ARP34400_P050) antibody
Sample Type Confirmation:

CIAO1 is supported by BioGPS gene expression data to be expressed in 721_B, MCF7

Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Tell us what you think about this item!

Write A Review
    Please, wait...