TSG101 Antibody - middle region (ARP37310_T100)

Catalog No: ARP37310_T100

WB Suggested Anti-TSG101 Antibody Titration: 1.25ug/ml
Positive Control: NIH/3T3 cell lysate

Sample Type: mouse fibroblast lusate (10ug)
Primary Dilution: 1:1000 (1% BSA)
Secondary Dilution: 1:2000 (5% milk)
Image Submitted By: 
Anonymous researcher See Customer Feedback tab for detailed information.

WB Suggested Anti-TSG101 Antibody
Positive Control: Lane 1: 30ug mouse brain lysate Lane 2: 30ug mouse brain lysate Lane 3: 30ug mouse brain lysate
Primary Antibody Dilution : 1:1000
Secondary Antibody : Goat anti-rabbit-HRP
Secondry Antibody Dilution : 1:50,000
Submitted by: Teresa Gunn, McLaughin Research Institute

Rabbit Anti-Tsg101 Antibody
Catalog Number: ARP37310
Paraffin Embedded Tissue: Mouse Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Publications:

  Isolation of Exosomes and Microvesicles from Cell Culture Systems to Study Prion Transmission. Methods Mol. Biol. 1545, 153-176 (2017). 27943213

  More...

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 93%; Horse: 79%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-TSG101 (ARP37310_T100) antibody is Catalog # AAP37310 (Previous Catalog # AAPS05712)

Target Info

• Reference: Stefan,M., (er) BMC Genomics 6, 157 (2005)
• Gene Symbol: TSG101
• Gene Full Name: Tumor susceptibility gene 101
• Alias Symbols: CC2, AI255943
• NCBI Gene Id: 22088
• Protein Name: Tumor susceptibility gene 101 protein
• Description of Target: TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer.
• Uniprot ID: Q61187
• Protein Accession #: NP_068684
• Nucleotide Accession #: NM_021884
• Protein Size (# AA): 391
• Molecular Weight: 43kDa
• Protein Interactions: Nr3c2; Ndfip1; SH3KBP1; Ppp1cc; Gjd3; Gjb3; Gjc1; Gja1; Ubc; Mgrn1; Tsg101; Nfe2; Ikbkg; Gmcl1;