Search Antibody, Protein, and ELISA Kit Solutions

TSG101 antibody - middle region (ARP37911_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37911_T100-FITC Conjugated

ARP37911_T100-HRP Conjugated

ARP37911_T100-Biotin Conjugated

Gene Symbol:
TSG101
NCBI Gene Id:
22088
Official Gene Full Name:
Tumor susceptibility gene 101
Protein Name:
Tumor susceptibility gene 101 protein
Swissprot Id:
Q61187
Protein Accession #:
NP_068684
Nucleotide Accession #:
NM_021884
Alias Symbols:
CC2, AI255943
Replacement Item:
This antibody may replace item sc-101254 from Santa Cruz Biotechnology.
Description of Target:
TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer.
Protein Size (# AA):
391
Molecular Weight:
43kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TSG101.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TSG101.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 87%; Dog: 87%; Goat: 87%; Guinea Pig: 93%; Horse: 87%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 79%
Complete computational species homology data:
Anti-TSG101 (ARP37911_T100)
Peptide Sequence:
Synthetic peptide located within the following region: YMPGMPSGISAYPSGYPPNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Nr3c2; Ndfip1; SH3KBP1; Ppp1cc; Gjd3; Gjb3; Gjc1; Gja1; Ubc; Mgrn1; Tsg101; Nfe2; Ikbkg; Gmcl1;
Blocking Peptide:
For anti-TSG101 (ARP37911_T100) antibody is Catalog # AAP37911 (Previous Catalog # AAPP10091)
Datasheets/Manuals:
Printable datasheet for anti-TSG101 (ARP37911_T100) antibody
Target Reference:
Stefan,M., et al., (er) BMC Genomics 6, 157 (2005)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...