Search Antibody, Protein, and ELISA Kit Solutions

TNFSF15 Antibody - C-terminal region (ARP80865_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
TNFSF15
Official Gene Full Name:
tumor necrosis factor superfamily member 15
NCBI Gene Id:
9966
Protein Name:
tumor necrosis factor ligand superfamily member 15
Swissprot Id:
O95150-2
Protein Accession #:
NP_001191273.1
Nucleotide Accession #:
NM_001204344.1
Alias Symbols:
TL1, TL1A, VEGI, TNLG1B, VEGI192A
Description of Target:
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
192
Molecular Weight:
21 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TNFSF15.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TNFSF15.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human TNFSF15
Peptide Sequence:
Synthetic peptide located within the following region: CEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TNFSF15 (ARP80865_P050) antibody is Catalog # AAP80865
Datasheets/Manuals:
Printable datasheet for anti-TNFSF15 (ARP80865_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...