Search Antibody, Protein, and ELISA Kit Solutions

TNFSF10 Antibody - middle region (ARP97933_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
TNFSF10
Official Gene Full Name:
tumor necrosis factor superfamily member 10
NCBI Gene Id:
8743
Protein Name:
Tumor necrosis factor ligand superfamily member 10
Swissprot Id:
P50591
Protein Accession #:
NP_001177871.1
Nucleotide Accession #:
NM_001190942.1
Alias Symbols:
TL2, APO2L, CD253, TRAIL, Apo-2L, TNLG6A
Description of Target:
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
281
Molecular Weight:
33 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TNFSF10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TNFSF10.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TNFSF10
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: ACFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TNFSF10 (ARP97933_P050) antibody is Catalog # AAP97933
Datasheets/Manuals:
Printable datasheet for anti-TNFSF10 (ARP97933_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...