| Product Number |
ARP97933_P050 |
| Product Page |
www.avivasysbio.com/tnfsf10-antibody-middle-region-arp97933-p050.html |
| Name |
TNFSF10 Antibody - middle region (ARP97933_P050) |
| Protein Size (# AA) |
281 amino acids |
| Molecular Weight |
33 kDa |
| NCBI Gene Id |
8743 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
tumor necrosis factor superfamily member 10 |
| Alias Symbols |
TL2, APO2L, CD253, TRAIL, Apo-2L, TNLG6A |
| Peptide Sequence |
Synthetic peptide located within the following region: ACFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TNFSF10 (ARP97933_P050) antibody |
| Blocking Peptide |
For anti-TNFSF10 (ARP97933_P050) antibody is Catalog # AAP97933 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TNFSF10 |
| Uniprot ID |
P50591 |
| Protein Name |
Tumor necrosis factor ligand superfamily member 10 |
| Protein Accession # |
NP_001177871.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001190942.1 |
| Gene Symbol |
TNFSF10 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human HT1080 Whole Cell
 | Host: Rabbit
Target Name: TNFSF10
Sample Tissue: Human HT1080 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
