Search Antibody, Protein, and ELISA Kit Solutions

TMEFF2 Antibody - C-terminal region (ARP47224_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP47224_P050-FITC Conjugated

ARP47224_P050-HRP Conjugated

ARP47224_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-135250 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEFF2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-TMEFF2 (ARP47224_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANK
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TMEFF2 (ARP47224_P050) antibody is Catalog # AAP47224
Printable datasheet for anti-TMEFF2 (ARP47224_P050) antibody
Gene Symbol:
Official Gene Full Name:
transmembrane protein with EGF-like and two follistatin-like domains 2
NCBI Gene Id:
Protein Name:
Description of Target:
TMEFF2 may be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation.
Swissprot Id:
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TMEFF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TMEFF2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...