Product Number |
ARP47224_P050 |
Product Page |
www.avivasysbio.com/tmeff2-antibody-c-terminal-region-arp47224-p050.html |
Name |
TMEFF2 Antibody - C-terminal region (ARP47224_P050) |
Protein Size (# AA) |
346 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
23671 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
transmembrane protein with EGF-like and two follistatin-like domains 2 |
Alias Symbols |
TR, HPP1, TPEF, TR-2, TENB2, CT120.2 |
Peptide Sequence |
Synthetic peptide located within the following region: NACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
TMEFF2 may be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation. |
Protein Interactions |
AGO2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TMEFF2 (ARP47224_P050) antibody |
Blocking Peptide |
For anti-TMEFF2 (ARP47224_P050) antibody is Catalog # AAP47224 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEFF2 |
Uniprot ID |
Q9UIK5-2 |
Protein Name |
Tomoregulin-2 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
TMEFF2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Colorectal Tumor
| Host: Rabbit Target Name: TMEFF2 Sample Type: Colorectal Tumor lysates Antibody Dilution: 1.0ug/ml |
|
|