TMEFF2 Antibody - C-terminal region (ARP47224_P050)

Data Sheet
 
Product Number ARP47224_P050
Product Page www.avivasysbio.com/tmeff2-antibody-c-terminal-region-arp47224-p050.html
Name TMEFF2 Antibody - C-terminal region (ARP47224_P050)
Protein Size (# AA) 346 amino acids
Molecular Weight 38kDa
NCBI Gene Id 23671
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name transmembrane protein with EGF-like and two follistatin-like domains 2
Alias Symbols TR, HPP1, TPEF, TR-2, TENB2, CT120.2
Peptide Sequence Synthetic peptide located within the following region: NACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target TMEFF2 may be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation.
Protein Interactions AGO2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TMEFF2 (ARP47224_P050) antibody
Blocking Peptide For anti-TMEFF2 (ARP47224_P050) antibody is Catalog # AAP47224
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEFF2
Uniprot ID Q9UIK5-2
Protein Name Tomoregulin-2
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol TMEFF2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Colorectal Tumor
Host: Rabbit
Target Name: TMEFF2
Sample Type: Colorectal Tumor lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com