SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: P100611_P050-Biotin
Size:100ul
Price: $434.00
SKU
P100611_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TLX1 Antibody - middle region : Biotin (P100611_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-TLX1 (P100611_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TLX1
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: VAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTGHPY
Concentration0.5 mg/ml
Blocking PeptideFor anti-TLX1 (P100611_P050-Biotin) antibody is Catalog # AAP30921 (Previous Catalog # AAPP01645)
ReferenceBaak,U., (2008) Leukemia 22 (6), 1154-1160
Gene SymbolTLX1
Gene Full NameT-cell leukemia homeobox 1
Alias SymbolsTCL3, HOX11
NCBI Gene Id3195
Protein NameT-cell leukemia homeobox protein 1
Description of TargetTLX1 contains 1 homeobox DNA-binding domain. TLX1 controls the genesis of the spleen. A chromosomal aberration involving TLX1, translocation t(10;14)(q24;q11) with TCRD, may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL).
Uniprot IDP31314
Protein Accession #NP_005512
Nucleotide Accession #NM_005521
Protein Size (# AA)330
Molecular Weight34kDa
Protein InteractionsTLE1; PPP1CC; PPP1CB; NFIC; PPP2CA; PKNOX1; MEIS1; TLX1; PPP2CB;
  1. What is the species homology for "TLX1 Antibody - middle region : Biotin (P100611_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "TLX1 Antibody - middle region : Biotin (P100611_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TLX1 Antibody - middle region : Biotin (P100611_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TLX1 Antibody - middle region : Biotin (P100611_P050-Biotin)"?

    This target may also be called "TCL3, HOX11" in publications.

  5. What is the shipping cost for "TLX1 Antibody - middle region : Biotin (P100611_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TLX1 Antibody - middle region : Biotin (P100611_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TLX1 Antibody - middle region : Biotin (P100611_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TLX1 Antibody - middle region : Biotin (P100611_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TLX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TLX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TLX1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TLX1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TLX1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TLX1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TLX1 Antibody - middle region : Biotin (P100611_P050-Biotin)
Your Rating
We found other products you might like!