Search Antibody, Protein, and ELISA Kit Solutions

TLX1 Antibody - middle region (P100611_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100611_P050-FITC Conjugated

P100611_P050-HRP Conjugated

P100611_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
TLX1
Official Gene Full Name:
T-cell leukemia homeobox 1
NCBI Gene Id:
3195
Protein Name:
T-cell leukemia homeobox protein 1
Swissprot Id:
P31314
Protein Accession #:
NP_005512
Nucleotide Accession #:
NM_005521
Alias Symbols:
HOX11, MGC163402, TCL3
Description of Target:
TLX1 contains 1 homeobox DNA-binding domain. TLX1 controls the genesis of the spleen. A chromosomal aberration involving TLX1, translocation t(10;14)(q24;q11) with TCRD, may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL).
Protein Size (# AA):
330
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TLX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TLX1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TLX1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-TLX1 (P100611_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTGHPY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TLE1; PPP1CC; PPP1CB; NFIC; PPP2CA; PKNOX1; MEIS1; TLX1; PPP2CB;
Blocking Peptide:
For anti-TLX1 (P100611_P050) antibody is Catalog # AAP30921 (Previous Catalog # AAPP01645)
Datasheets/Manuals:
Printable datasheet for anti-TLX1 (P100611_P050) antibody
Target Reference:
Baak,U., (2008) Leukemia 22 (6), 1154-1160

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...