TIGIT Antibody - C-terminal region (ARP66485_P050)

Catalog No: ARP66485_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: TIGIT
Sample Tissue: Human Fetal Kidney
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: TIGIT
Sample Tissue: Human MCF7 Whole Cell
Antibody Dilution: 0.5ug/ml

Host: Rabbit
Target: TIGIT
Positive control (+): Human lung (LU)
Negative control (-): Human Ovary (OV)
Antibody concentration: 0.5ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TIGIT
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGED
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TIGIT (ARP66485_P050) antibody is Catalog # AAP66485

Target Info

• Gene Symbol: TIGIT
• Alias Symbols: VSIG9, VSTM3, WUCAM
• NCBI Gene Id: 201633
• Protein Name: T-cell immunoreceptor with Ig and ITIM domains
• Description of Target: This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
• Uniprot ID: Q495A1
• Protein Accession #: NP_776160
• Nucleotide Accession #: NM_173799
• Protein Size (# AA): 244
• Molecular Weight: 26kDa
• Protein Interactions: PVRL4; PVRL3; PVRL2; PVR;