Search Antibody, Protein, and ELISA Kit Solutions

TBX10 antibody - N-terminal region (ARP31986_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31986_P050-FITC Conjugated

ARP31986_P050-HRP Conjugated

ARP31986_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
T-box 10
Protein Name:
T-box transcription factor TBX10
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
TBX10, a member of the Tbx1-subfamily of conserved developmental genes, is located at human chromosome 11q13 and proximal mouse chromosome 19.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBX10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBX10.
The immunogen is a synthetic peptide directed towards the N terminal region of human TBX10
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 92%
Complete computational species homology data:
Anti-TBX10 (ARP31986_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TSSTGAQAVAEPTGQGPKNPRVSRVTVQLEMKPLWEEFNQLGTEMIVTKA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TBX10 (ARP31986_P050) antibody is Catalog # AAP31986 (Previous Catalog # AAPP02883)
Printable datasheet for anti-TBX10 (ARP31986_P050) antibody
Target Reference:
Bush,J.O., et al., (2003) Gene Expr. Patterns 3 (4), 533-538

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...