| Product Number |
ARP31986_P050 |
| Product Page |
www.avivasysbio.com/tbx10-antibody-n-terminal-region-arp31986-p050.html |
| Name |
TBX10 Antibody - N-terminal region (ARP31986_P050) |
| Protein Size (# AA) |
385 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
347853 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
T-box 10 |
| Alias Symbols |
TBX7, TBX13 |
| Peptide Sequence |
Synthetic peptide located within the following region: TSSTGAQAVAEPTGQGPKNPRVSRVTVQLEMKPLWEEFNQLGTEMIVTKA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Bush,J.O., et al., (2003) Gene Expr. Patterns 3 (4), 533-538 |
| Description of Target |
TBX10, a member of the Tbx1-subfamily of conserved developmental genes, is located at human chromosome 11q13 and proximal mouse chromosome 19. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TBX10 (ARP31986_P050) antibody |
| Blocking Peptide |
For anti-TBX10 (ARP31986_P050) antibody is Catalog # AAP31986 (Previous Catalog # AAPP02883) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TBX10 |
| Uniprot ID |
O75333 |
| Protein Name |
T-box transcription factor TBX10 |
| Protein Accession # |
NP_005986 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005995 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
TBX10 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Horse, Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 92% |
| Image 1 | Human Muscle
 | WB Suggested Anti-TBX10 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle |
| | Image 2 | Human Adult Liver
 | Rabbit Anti-TBX10 Antibody
Catalog Number: ARP31986_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Nuclear in hepatocytes, strong signal, wide tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
| | Image 3 | Mouse Skeletal Muscle
 | Host: Mouse
Target Name: TBX10
Sample Tissue: Mouse Skeletal Muscle
Antibody Dilution: 1ug/ml |
|
|
