Search Antibody, Protein, and ELISA Kit Solutions

TACC2 Antibody - C-terminal region (ARP85355_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
transforming acidic coiled-coil containing protein 2
NCBI Gene Id:
Protein Name:
transforming acidic coiled-coil-containing protein 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
Transforming acidic coiled-coil proteins are a conserved family of centrosome- and microtubule-interacting proteins that are implicated in cancer. This gene encodes a protein that concentrates at centrosomes throughout the cell cycle. This gene lies within a chromosomal region associated with tumorigenesis. Expression of this gene is induced by erythropoietin and is thought to affect the progression of breast tumors. Several transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
112 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TACC2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TACC2.
The immunogen is a synthetic peptide directed towards the C terminal region of human TACC2
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: PASAMEANGVDGDGLNKPAKKKKTPLKTDTFRVKKSPKRSPLSDPPSQDP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TACC2 (ARP85355_P050) antibody is Catalog # AAP85355
Printable datasheet for anti-TACC2 (ARP85355_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...