Sku |
AAP85355 |
Price |
99 |
Name |
TACC2 Peptide - C-terminal region (AAP85355) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
TACC2 |
Alias symbols |
AZU-1, ECTACC |
Gene id |
10579 |
Description of target |
Transforming acidic coiled-coil proteins are a conserved family of centrosome- and microtubule-interacting proteins that are implicated in cancer. This gene encodes a protein that concentrates at centrosomes throughout the cell cycle. This gene lies within a chromosomal region associated with tumorigenesis. Expression of this gene is induced by erythropoietin and is thought to affect the progression of breast tumors. Several transcript variants encoding different isoforms have been found for this gene. |
Swissprot id |
O95359-1 |
Protein accession num |
NP_001278807.1 |
Nucleotide accession num |
NM_001291878.1 |
Protein size |
1026 amino acids |
Molecular weight |
112 kDa |
Species reactivity |
Human |
Peptide sequence |
Synthetic peptide located within the following region: PASAMEANGVDGDGLNKPAKKKKTPLKTDTFRVKKSPKRSPLSDPPSQDP |
Quality control |
The peptide is characterized by mass spectroscopy |
Description |
This is a synthetic peptide designed for use in combination with anti- TACC2 Antibody (ARP85355_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |