SOX6 Antibody - middle region (ARP33148_P050)

Catalog No: ARP33148_P050

WB Suggested Anti-SOX6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Host: Mouse
Target Name: SOX6
Sample Tissue: Mouse Skeletal Muscle
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SOX6
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: YGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SOX6 (ARP33148_P050) antibody is Catalog # AAP33148 (Previous Catalog # AAPP04181)
• Reference: Ikeda,T., (2007) Biochem. Biophys. Res. Commun. 357 (2), 383-390

Target Info

• Gene Symbol: SOX6
• Gene Full Name: SRY (sex determining region Y)-box 6
• Alias Symbols: SOXD, HSSOX6, TOLCAS
• NCBI Gene Id: 55553
• Description of Target: SOX6 is a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved DNA-binding domain termed the high mobility group box and by their ability to bind the minor groove of DNA. SOX6 is a transcriptional activator that is required for normal development of the central nervous system, chondrogenesis and maintenance of cardiac and skeletal muscle cells. SOX6 interacts with other family members to cooperatively activate gene expression.Members of the SOX gene family, such as SOX6, encode transcription factors defined by the conserved high mobility group (HMG) DNA-binding domain. Unlike most transcription factors, SOX transcription factors bind to the minor groove of DNA, causing a 70- to 85-degree bend and introducing local conformational changes (Cohen-Barak et al., 2001 [PubMed 11255018]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2696 AL136780.1 1-2696 2697-5158 AC009869.7 10394-12855
• Uniprot ID: A8MRT1
• Protein Accession #: NP_059978
• Nucleotide Accession #: NM_017508
• Protein Size (# AA): 804
• Molecular Weight: 89kDa
• Protein Interactions: TAF4; TRIP12; UBC; SOX2; POMGNT1; ZNF184; UBE2J1; SUMO1; SUMO2; SUMO3; HDAC1; CTNNB1; SOX5; CENPK; DAZAP2; SOX6; CTBP2;