Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP31737_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31737_P050-FITC Conjugated

ARP31737_P050-HRP Conjugated

ARP31737_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse, Frog
Predicted Species Reactivity Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Kidney
IHC Information: Thymus
IHC Information: Spleen
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-17319 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SOX2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 91%
Complete computational species homology data Anti-SOX2 (ARP31737_P050)
Peptide Sequence Synthetic peptide located within the following region: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SOX2 (ARP31737_P050) antibody is Catalog # AAP31737 (Previous Catalog # AAPP02528)
Datasheets/Manuals Printable datasheet for anti-SOX2 (ARP31737_P050) antibody
Sample Type Confirmation

There is BioGPS gene expression data showing that SOX2 is expressed in OVCAR3

Target Reference Wang,P., (2008) Arch. Ophthalmol. 126 (5), 709-713
Publications

Perry, K. J., Thomas, A. G. & Henry, J. J. Expression of pluripotency factors in larval epithelia of the frog Xenopus: evidence for the presence of cornea epithelial stem cells. Dev. Biol. 374, 281-94 (2013). IHC, WB, Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 23274420

Gene Symbol SOX2
Official Gene Full Name SRY (sex determining region Y)-box 2
Alias Symbols ANOP3, MCOPS3, MGC2413
NCBI Gene Id 6657
Protein Name Transcription factor SOX-2
Description of Target SOX2 is a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The protein may act as a transcriptional activator after forming a protein complex with other proteins. Mutations in this gene have been associated with bilateral anophthalmia, a severe form of structural eye malformation. This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P48431
Protein Accession # NP_003097
Nucleotide Accession # NM_003106
Protein Size (# AA) 317
Molecular Weight 34kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SOX2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SOX2.
Protein Interactions SUMO1; DMAP1; TBX2; SETD7; FAM21A; FZR1; MMS19; MRPS35; ZNF462; LSM2; CCAR2; MIER1; ZDBF2; CHD8; EP400; TSHZ3; RANBP10; ZNF687; XPO5; INTS2; MTA3; CORO1B; CASC5; MRPS22; KCMF1; MEPCE; TRERF1; INTS9; PARVA; SCYL2; CHD7; ZCCHC8; SOX6; BRIX1; SAMD4B; GID8; C
  1. What is the species homology for "SOX2 Antibody - N-terminal region (ARP31737_P050)"?

    The tested species reactivity for this item is "Human, Mouse, Frog". This antibody is predicted to have homology to "Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish".

  2. How long will it take to receive "SOX2 Antibody - N-terminal region (ARP31737_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SOX2 Antibody - N-terminal region (ARP31737_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SOX2 Antibody - N-terminal region (ARP31737_P050)"?

    This target may also be called "ANOP3, MCOPS3, MGC2413" in publications.

  5. What is the shipping cost for "SOX2 Antibody - N-terminal region (ARP31737_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SOX2 Antibody - N-terminal region (ARP31737_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SOX2 Antibody - N-terminal region (ARP31737_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SOX2 Antibody - N-terminal region (ARP31737_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SOX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SOX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SOX2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SOX2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SOX2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SOX2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SOX2 Antibody - N-terminal region (ARP31737_P050)
Your Rating
We found other products you might like!