Search Antibody, Protein, and ELISA Kit Solutions

SOX2 antibody - N-terminal region (ARP31737_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31737_P050-FITC Conjugated

ARP31737_P050-HRP Conjugated

ARP31737_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
SRY (sex determining region Y)-box 2
Protein Name:
Transcription factor SOX-2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-17319 from Santa Cruz Biotechnology.
Description of Target:
SOX2 is a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The protein may act as a transcriptional activator after forming a protein complex with other proteins. Mutations in this gene have been associated with bilateral anophthalmia, a severe form of structural eye malformation. This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOX2.
The immunogen is a synthetic peptide directed towards the N terminal region of human SOX2
Tested Species Reactivity:
Human, Mouse, Frog
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 91%
Complete computational species homology data:
Anti-SOX2 (ARP31737_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SOX2 (ARP31737_P050) antibody is Catalog # AAP31737 (Previous Catalog # AAPP02528)
Printable datasheet for anti-SOX2 (ARP31737_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that SOX2 is expressed in OVCAR3

Additional Information:
IHC Information: Kidney
IHC Information: Thymus
IHC Information: Spleen
Target Reference:
Wang,P., (2008) Arch. Ophthalmol. 126 (5), 709-713

Perry, K. J., Thomas, A. G. & Henry, J. J. Expression of pluripotency factors in larval epithelia of the frog Xenopus: evidence for the presence of cornea epithelial stem cells. Dev. Biol. 374, 281-94 (2013). IHC, WB, Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 23274420

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: SOX2 antibody-N-terminal region (ARP31737_P050) in Xenopus laevis cornea epithellium using IHC
Product Page for SOX2 antibody-N-terminal region (ARP31737_P050)

Researcher: Kim Perry, University of Illinois
Application: IHC
Species + Tissue/Cell type: Xenopus laevis cornea epithellium
Primary antibody dilution: 1:300
Secondary antibody: Goat anti-rabbit -rhodamine
Secondary antibody dilution: 1:300

Publication of this experiment:
1: Perry KJ, Thomas AG, Henry JJ. Expression of pluripotency factors in larval epithelia of the frog Xenopus: Evidence for the presence of cornea epithelial stem cells. Dev Biol. 2013 Feb 15;374(2):281-94. doi: 10.1016/j.ydbio.2012.12.005. Epub 2012 Dec 26. PubMed PMID: 23274420; PubMed Central PMCID: PMC3558918.

How do Aviva's reagents play a role in your experimental goals? Finding antibodies that work well in Xenopus is our primary goal to help us further our research.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4 - Stains well at a reasonable concentration, although not the most robust antibody I've ever used.
Would you use this antibody in future experiments? Yes.
Have you used another antibody which has worked in your application? No, this is the only Sox2 antibody that has worked thus far.
Do you believe the information about the reagent on Aviva's website is correct? Yes.
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, definitely.  In fact, a manuscript is currently in the works.
How did you store the antibody after re-suspension? Aliquots at -80 d C and working aliquot at -20 d C.
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Xenopus laevis cornea epithelium
Please explain fixation solution/method used (formalin, perodate-lysine-paraformaldehyde, acetone, etc.)? 4% paraformaldehyde diluted in 1X PBS
How many different experimental trials were conducted using the antibody sample? 3 independent experimental trials.
Primary antibody dilution, incubation time and temperature: 1:300 dilution, incubated for 2 hours at room temp or overnight at 4 d C
Secondary antibody used, dilution, incubation time and temperature: 1:300 goat anti-rabbit rhodamine or fluorescein
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: Red represents Sox2 and blue represents nuclei (DAPI)
Did you use an antigen retrieval method? If so, please explain? No.
What controls were used in your experiment? Incubation with secondary alone and incubation with primary and no secondary.
Please include your detailed tissue preparation and staining procedure/protocol here: Whole Xenopus larvae were fixed in 4% paraformaldehyde diluted in 1X PBS for 2 hours at room temperature, followed by 3 washes in 1X PBS (approximately 10 minutes each).  Eyes were excised from each animal and incubated in 0.5%Triton diluted in 1X PBS to permeabilize the tissue.  Eyes were blocked in 1% goat serum diluted in 0.5%Triton/1X PBS for 2 hours.  Sox2 antibody incubation followed (1:200 diluted in blocking solution) overnight at 4*C.  Three 0.5%Triton/1X PBS washes (10 minutes each) were followed by incubation in secondary antibody (1:300  goat anti-rabbit rhodamine or fluorescein) for 1.5 hours at room temperature.  Whole eyes were then washed three times in 1X PBS.  Corneas were then removed from the whole eye and placed on a slide in a drop of 1X PBS.  DAPI (1um) was added to each cornea for 10 minutes, washed well with 1X PBS and corneas mounted in ProLong Gold under a coverslip.
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...