- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-SMC1A (ARP38780_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB, IHC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SMC1A |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
Peptide Sequence | Synthetic peptide located within the following region: VISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SMC1A (ARP38780_P050) antibody is Catalog # AAP38780 (Previous Catalog # AAPP20985) |
Sample Type Confirmation | SMC1A is supported by BioGPS gene expression data to be expressed in HEK293T, HepG2, Jurkat |
Reference | Barber,T.D., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (9), 3443-3448 |
Gene Symbol | SMC1A |
---|---|
Gene Full Name | Structural maintenance of chromosomes 1A |
Alias Symbols | SMC1, SMCB, CDLS2, DEE85, SB1.8, EIEE85, SMC1L1, DXS423E, SMC1alpha |
NCBI Gene Id | 8243 |
Protein Name | Structural maintenance of chromosomes protein 1A |
Description of Target | The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1L2 or the protein encoded by SMC1A gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the SMC1A protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. Proper cohesion of sister chromatids is a prerequisite for the correct segregation of chromosomes during cell division. The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1L2 or the protein encoded by this gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the encoded protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. This gene, which belongs to the SMC gene family, is located in an area of the X-chromosome that escapes X inactivation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | Q14683 |
Protein Accession # | NP_006297 |
Nucleotide Accession # | NM_006306 |
Protein Size (# AA) | 1233 |
Molecular Weight | 143kDa |
Protein Interactions | UBC; SUMO2; STAU1; RPA3; RPA2; RPA1; RNF2; EED; KIF13A; ARMCX3; CDK20; ANKRD28; HDAC11; HDAC8; SMC1A; RFC1; POLA1; MCM7; MCM6; METTL21B; WHSC1; NOTCH1; SF3B3; ACIN1; SMC2; RBM14; SMC3; RAD21; NSMCE2; FBXO6; CUL3; NEDD8; CDK2; CEBPA; CDK8; NIPBL; MDC1; POL |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SMC1A Antibody - C-terminal region (ARP38780_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "SMC1A Antibody - C-terminal region (ARP38780_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "SMC1A Antibody - C-terminal region (ARP38780_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SMC1A Antibody - C-terminal region (ARP38780_P050)"?
This target may also be called "SMC1, SMCB, CDLS2, DEE85, SB1.8, EIEE85, SMC1L1, DXS423E, SMC1alpha" in publications.
-
What is the shipping cost for "SMC1A Antibody - C-terminal region (ARP38780_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SMC1A Antibody - C-terminal region (ARP38780_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SMC1A Antibody - C-terminal region (ARP38780_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "143kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SMC1A Antibody - C-terminal region (ARP38780_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SMC1A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SMC1A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SMC1A"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SMC1A"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SMC1A"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SMC1A"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.