Search Antibody, Protein, and ELISA Kit Solutions

SLC6A9 Antibody - middle region (ARP42329_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42329_P050-FITC Conjugated

ARP42329_P050-HRP Conjugated

ARP42329_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
SLC6A9
Official Gene Full Name:
solute carrier family 6 member 9
NCBI Gene Id:
6536
Protein Name:
sodium- and chloride-dependent glycine transporter 1
Swissprot Id:
P48067
Protein Accession #:
NP_964012
Alias Symbols:
GLYT1, GCENSG
Description of Target:
The amino acid glycine acts as an inhibitory neurotransmitter in the central nervous system. The protein encoded by this gene is one of two transporters that stop glycine signaling by removing it from the synaptic cleft.
Protein Size (# AA):
706
Molecular Weight:
77kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC6A9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC6A9.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human SC6A9
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SLC6A9 (ARP42329_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; GABRR1; STX1A; PRKCA;
Blocking Peptide:
For anti-SLC6A9 (ARP42329_P050) antibody is Catalog # AAP42329
Datasheets/Manuals:
Printable datasheet for anti-SLC6A9 (ARP42329_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...