| Product Number |
ARP42329_P050 |
| Product Page |
www.avivasysbio.com/slc6a9-antibody-middle-region-arp42329-p050.html |
| Name |
SLC6A9 Antibody - middle region (ARP42329_P050) |
| Protein Size (# AA) |
706 amino acids |
| Molecular Weight |
77kDa |
| NCBI Gene Id |
6536 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
solute carrier family 6 member 9 |
| Alias Symbols |
GLYT1, GCENSG |
| Peptide Sequence |
Synthetic peptide located within the following region: WLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The amino acid glycine acts as an inhibitory neurotransmitter in the central nervous system. The protein encoded by this gene is one of two transporters that stop glycine signaling by removing it from the synaptic cleft. |
| Protein Interactions |
UBC; GABRR1; STX1A; PRKCA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC6A9 (ARP42329_P050) antibody |
| Blocking Peptide |
For anti-SLC6A9 (ARP42329_P050) antibody is Catalog # AAP42329 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human SC6A9 |
| Uniprot ID |
P48067 |
| Protein Name |
sodium- and chloride-dependent glycine transporter 1 |
| Protein Accession # |
NP_964012 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC6A9 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Fetal Lung
 | Host: Rabbit
Target Name: SC6A9
Sample Type: Fetal Lung lysates
Antibody Dilution: 1.0ug/ml |
|
|
