Search Antibody, Protein, and ELISA Kit Solutions

SLC17A7 Antibody - N-terminal region (ARP44003_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44003_P050-FITC Conjugated

ARP44003_P050-HRP Conjugated

ARP44003_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
SLC17A7
Official Gene Full Name:
solute carrier family 17 member 7
NCBI Gene Id:
57030
Protein Name:
vesicular glutamate transporter 1
Swissprot Id:
Q9P2U7
Protein Accession #:
NP_064705
Alias Symbols:
BNPI, VGLUT1
Description of Target:
The protein encoded by this gene is a vesicle-bound, sodium-dependent phosphate transporter that is specifically expressed in the neuron-rich regions of the brain. It is preferentially associated with the membranes of synaptic vesicles and functions in glutamate transport. The protein shares 82% identity with the differentiation-associated Na-dependent inorganic phosphate cotransporter and they appear to form a distinct class within the Na+/Pi cotransporter family.
Protein Size (# AA):
560
Molecular Weight:
61kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC17A7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC17A7.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human VGLU1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SLC17A7 (ARP44003_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SH3GL2;
Blocking Peptide:
For anti-SLC17A7 (ARP44003_P050) antibody is Catalog # AAP44003
Datasheets/Manuals:
Printable datasheet for anti-SLC17A7 (ARP44003_P050) antibody
Conjugation:
Unconjugated

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...