Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP44003_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44003_P050-FITC Conjugated

ARP44003_P050-HRP Conjugated

ARP44003_P050-Biotin Conjugated

SLC17A7 Antibody - N-terminal region (ARP44003_P050)

Catalog#: ARP44003_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ConjugationUnconjugated
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human VGLU1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-SLC17A7 (ARP44003_P050)
Peptide SequenceSynthetic peptide located within the following region: GLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLI
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-SLC17A7 (ARP44003_P050) antibody is Catalog # AAP44003
Datasheets/ManualsPrintable datasheet for anti-SLC17A7 (ARP44003_P050) antibody
Gene SymbolSLC17A7
Official Gene Full Namesolute carrier family 17 member 7
Alias SymbolsBNPI, VGLUT1
NCBI Gene Id57030
Protein Namevesicular glutamate transporter 1
Description of TargetThe protein encoded by this gene is a vesicle-bound, sodium-dependent phosphate transporter that is specifically expressed in the neuron-rich regions of the brain. It is preferentially associated with the membranes of synaptic vesicles and functions in glutamate transport. The protein shares 82% identity with the differentiation-associated Na-dependent inorganic phosphate cotransporter and they appear to form a distinct class within the Na+/Pi cotransporter family.
Swissprot IdQ9P2U7
Protein Accession #NP_064705
Protein Size (# AA)560
Molecular Weight61kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SLC17A7.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SLC17A7.
Protein InteractionsSH3GL2;
Write Your Own Review
You're reviewing:SLC17A7 Antibody - N-terminal region (ARP44003_P050)
Your Rating
Free Microscope
Aviva Blast Tool
Aviva Travel Grant
Aviva ChIP Antibodies