| Product Number |
ARP44003_P050 |
| Product Page |
www.avivasysbio.com/slc17a7-antibody-n-terminal-region-arp44003-p050.html |
| Name |
SLC17A7 Antibody - N-terminal region (ARP44003_P050) |
| Protein Size (# AA) |
560 amino acids |
| Molecular Weight |
61kDa |
| Conjugation |
Unconjugated |
| NCBI Gene Id |
57030 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
solute carrier family 17 member 7 |
| Alias Symbols |
BNPI, VGLUT1 |
| Peptide Sequence |
Synthetic peptide located within the following region: GLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a vesicle-bound, sodium-dependent phosphate transporter that is specifically expressed in the neuron-rich regions of the brain. It is preferentially associated with the membranes of synaptic vesicles and functions in glutamate transport. The protein shares 82% identity with the differentiation-associated Na-dependent inorganic phosphate cotransporter and they appear to form a distinct class within the Na+/Pi cotransporter family. |
| Protein Interactions |
SH3GL2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC17A7 (ARP44003_P050) antibody |
| Blocking Peptide |
For anti-SLC17A7 (ARP44003_P050) antibody is Catalog # AAP44003 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human VGLU1 |
| Uniprot ID |
Q9P2U7 |
| Protein Name |
vesicular glutamate transporter 1 |
| Protein Accession # |
NP_064705 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC17A7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2 Whole Cell
 | Host: Rabbit
Target Name: VGLU1
Sample Type: HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
