Search Antibody, Protein, and ELISA Kit Solutions

SHMT2 Antibody - N-terminal region (ARP46128_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46128_T100-FITC Conjugated

ARP46128_T100-HRP Conjugated

ARP46128_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Serine hydroxymethyltransferase 2 (mitochondrial)
NCBI Gene Id:
Protein Name:
Serine hydroxymethyltransferase, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-113041 from Santa Cruz Biotechnology.
Description of Target:
SHMT2 plays a role in interconversion of serine and glycine.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SHMT2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SHMT2.
The immunogen is a synthetic peptide directed towards the N terminal region of human SHMT2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SHMT2 (ARP46128_T100)
Peptide Sequence:
Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SHMT2 (ARP46128_T100) antibody is Catalog # AAP46128 (Previous Catalog # AAPP26990)
Printable datasheet for anti-SHMT2 (ARP46128_T100) antibody
Additional Information:
IHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Target Reference:
Fu,T.F., (2001) Arch. Biochem. Biophys. 393 (1), 42-50

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...