Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SHMT2 antibody - C-terminal region (ARP46129_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP46129_P050-FITC Conjugated

ARP46129_P050-HRP Conjugated

ARP46129_P050-Biotin Conjugated

Gene Symbol:
SHMT2
NCBI Gene Id:
6472
Official Gene Full Name:
Serine hydroxymethyltransferase 2 (mitochondrial)
Protein Name:
Serine hydroxymethyltransferase, mitochondrial
Swissprot Id:
P34897
Protein Accession #:
NP_005403
Nucleotide Accession #:
NM_005412
Alias Symbols:
GLYA, SHMT
Replacement Item:
This antibody may replace item sc-113041 from Santa Cruz Biotechnology.
Description of Target:
SHMT2 plays a role in interconversion of serine and glycine.
Protein Size (# AA):
504
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SHMT2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SHMT2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human SHMT2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SHMT2 (ARP46129_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CMTM5; ARL6IP1; HUWE1; UBC; MDM2; PSMG3; TBC1D15; SNX6; CAND1; VPS35; LUC7L2; CYHR1; ARFIP1; GSPT2; JMJD6; IVNS1ABP; ATG7; SEC24D; H1FX; CUL5; STAT1; SNX1; SHMT1; PAWR; NASP; IDE; HIST1H1B; CTTN; ATP6V1C1; APEH; ADRB2; ATF2; APP; CUL1; CUL3; NDRG1; HDAC5;
Blocking Peptide:
For anti-SHMT2 (ARP46129_P050) antibody is Catalog # AAP46129 (Previous Catalog # AAPP26991)
Datasheets/Manuals:
Printable datasheet for anti-SHMT2 (ARP46129_P050) antibody
Additional Information:
IHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Target Reference:
Fu,T.F., (2001) Arch. Biochem. Biophys. 393 (1), 42-50

Tell us what you think about this item!

Write A Review
    Please, wait...