Search Antibody, Protein, and ELISA Kit Solutions

SHC1 Antibody - middle region (ARP87140_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
SHC1
Official Gene Full Name:
SHC (Src homology 2 domain containing) transforming protein 1
NCBI Gene Id:
6464
Protein Name:
SHC-transforming protein 1
Swissprot Id:
P29353-2
Protein Accession #:
NP_001123512.1
Nucleotide Accession #:
NM_001130040.1
Alias Symbols:
SHC, SHCA
Description of Target:
This gene encodes three main isoforms that differ in activities and subcellular location. While all three are adapter proteins in signal transduction pathways, the longest (p66Shc) may be involved in regulating life span and the effects of reactive oxygen species. The other two isoforms, p52Shc and p46Shc, link activated receptor tyrosine kinases to the Ras pathway by recruitment of the GRB2/SOS complex. p66Shc is not involved in Ras activation. Unlike the other two isoforms, p46Shc is targeted to the mitochondrial matrix. Several transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
473
Molecular Weight:
52 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SHC1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SHC1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SHC1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: ELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SHC1 (ARP87140_P050) antibody is Catalog # AAP87140
Datasheets/Manuals:
Printable datasheet for anti-SHC1 (ARP87140_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...