Size:100 ul
$289.00
In Stock
SKU
ARP74213_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP74213_P050 Unconjugated

ARP74213_P050-HRP Conjugated

ARP74213_P050-Biotin Conjugated

SEZ6L2 Antibody - middle region : FITC (ARP74213_P050-FITC)

Catalog#: ARP74213_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human SE6L2
Purification Affinity Purified
Peptide Sequence Synthetic peptide located within the following region: HRTASDAGFPVGSHVQYRCLPGYSLEGAAMLTCYSRDTGTPKWSDRVPKC
Concentration 0.5 mg/ml
Blocking Peptide For anti-SEZ6L2 (ARP74213_P050-FITC) antibody is Catalog # AAP74213
Datasheets/Manuals Printable datasheet for anti-SEZ6L2 (ARP74213_P050-FITC) antibody
Gene Symbol SEZ6L2
Official Gene Full Name seizure related 6 homolog like 2
Alias Symbols BSRPA, PSK-1
NCBI Gene Id 26470
Protein Name seizure 6-like protein 2
Description of Target This gene encodes a seizure-related protein that is localized on the cell surface. The gene is located in a region of chromosome 16p11.2 that is thought to contain candidate genes for autism spectrum disorders (ASD), though there is no evidence directly implicating this gene in ASD. Increased expression of this gene has been found in lung cancers, and the protein is therefore considered to be a novel prognostic marker for lung cancer. Alternative splicing of this gene results in multiple transcript variants.
Swissprot Id Q6UXD5-6
Protein Size (# AA) 809
Molecular Weight 88kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SEZ6L2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SEZ6L2.
Protein Interactions OASL; UNG; TK1; FOXA1; ETV5; UBC;
  1. What is the species homology for "SEZ6L2 Antibody - middle region : FITC (ARP74213_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "SEZ6L2 Antibody - middle region : FITC (ARP74213_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SEZ6L2 Antibody - middle region : FITC (ARP74213_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SEZ6L2 Antibody - middle region : FITC (ARP74213_P050-FITC)"?

    This target may also be called "BSRPA, PSK-1" in publications.

  5. What is the shipping cost for "SEZ6L2 Antibody - middle region : FITC (ARP74213_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SEZ6L2 Antibody - middle region : FITC (ARP74213_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SEZ6L2 Antibody - middle region : FITC (ARP74213_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "88kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SEZ6L2 Antibody - middle region : FITC (ARP74213_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SEZ6L2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SEZ6L2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SEZ6L2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SEZ6L2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SEZ6L2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SEZ6L2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SEZ6L2 Antibody - middle region : FITC (ARP74213_P050-FITC)
Your Rating
We found other products you might like!