Search Antibody, Protein, and ELISA Kit Solutions

SEZ6L2 Antibody - middle region : FITC (ARP74213_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74213_P050 Unconjugated

ARP74213_P050-HRP Conjugated

ARP74213_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
SEZ6L2
Official Gene Full Name:
seizure related 6 homolog like 2
NCBI Gene Id:
26470
Protein Name:
seizure 6-like protein 2
Swissprot Id:
Q6UXD5-6
Alias Symbols:
BSRPA, PSK-1
Description of Target:
This gene encodes a seizure-related protein that is localized on the cell surface. The gene is located in a region of chromosome 16p11.2 that is thought to contain candidate genes for autism spectrum disorders (ASD), though there is no evidence directly implicating this gene in ASD. Increased expression of this gene has been found in lung cancers, and the protein is therefore considered to be a novel prognostic marker for lung cancer. Alternative splicing of this gene results in multiple transcript variants.
Protein Size (# AA):
809
Molecular Weight:
88kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SEZ6L2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SEZ6L2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human SE6L2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: HRTASDAGFPVGSHVQYRCLPGYSLEGAAMLTCYSRDTGTPKWSDRVPKC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
OASL; UNG; TK1; FOXA1; ETV5; UBC;
Blocking Peptide:
For anti-SEZ6L2 (ARP74213_P050-FITC) antibody is Catalog # AAP74213
Datasheets/Manuals:
Printable datasheet for anti-SEZ6L2 (ARP74213_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...