| Product Number |
ARP74213_P050-FITC |
| Product Page |
www.avivasysbio.com/sez6l2-antibody-middle-region-fitc-arp74213-p050-fitc.html |
| Name |
SEZ6L2 Antibody - middle region : FITC (ARP74213_P050-FITC) |
| Protein Size (# AA) |
809 amino acids |
| Molecular Weight |
88kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
26470 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
seizure related 6 homolog like 2 |
| Alias Symbols |
BSRPA, PSK-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: HRTASDAGFPVGSHVQYRCLPGYSLEGAAMLTCYSRDTGTPKWSDRVPKC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
This gene encodes a seizure-related protein that is localized on the cell surface. The gene is located in a region of chromosome 16p11.2 that is thought to contain candidate genes for autism spectrum disorders (ASD), though there is no evidence directly implicating this gene in ASD. Increased expression of this gene has been found in lung cancers, and the protein is therefore considered to be a novel prognostic marker for lung cancer. Alternative splicing of this gene results in multiple transcript variants. |
| Protein Interactions |
OASL; UNG; TK1; FOXA1; ETV5; UBC; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SEZ6L2 (ARP74213_P050-FITC) antibody |
| Blocking Peptide |
For anti-SEZ6L2 (ARP74213_P050-FITC) antibody is Catalog # AAP74213 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human SE6L2 |
| Uniprot ID |
Q6UXD5-6 |
| Protein Name |
seizure 6-like protein 2 |
| Purification |
Affinity Purified |
| Gene Symbol |
SEZ6L2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
