Search Antibody, Protein, and ELISA Kit Solutions

SESN1 Antibody - middle region (ARP87808_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
SESN1
Official Gene Full Name:
sestrin 1
NCBI Gene Id:
27244
Protein Name:
sestrin-1
Swissprot Id:
Q9Y6P5-2
Protein Accession #:
NP_001186862.1
Nucleotide Accession #:
NM_001199933.1
Alias Symbols:
PA26, SEST1
Description of Target:
This gene encodes a member of the sestrin family. Sestrins are induced by the p53 tumor suppressor protein and play a role in the cellular response to DNA damage and oxidative stress. The encoded protein mediates p53 inhibition of cell growth by activating AMP-activated protein kinase, which results in the inhibition of the mammalian target of rapamycin protein. The encoded protein also plays a critical role in antioxidant defense by regenerating overoxidized peroxiredoxins, and the expression of this gene is a potential marker for exposure to radiation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Protein Size (# AA):
551
Molecular Weight:
60 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SESN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SESN1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human SESN1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: ESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYCW
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SESN1 (ARP87808_P050) antibody is Catalog # AAP87808
Datasheets/Manuals:
Printable datasheet for anti-SESN1 (ARP87808_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...