| Product Number |
ARP87808_P050 |
| Product Page |
www.avivasysbio.com/sesn1-antibody-middle-region-arp87808-p050.html |
| Name |
SESN1 Antibody - middle region (ARP87808_P050) |
| Protein Size (# AA) |
551 amino acids |
| Molecular Weight |
60 kDa |
| NCBI Gene Id |
27244 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
sestrin 1 |
| Alias Symbols |
PA26, SEST1 |
| Peptide Sequence |
Synthetic peptide located within the following region: ESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYCW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the sestrin family. Sestrins are induced by the p53 tumor suppressor protein and play a role in the cellular response to DNA damage and oxidative stress. The encoded protein mediates p53 inhibition of cell growth by activating AMP-activated protein kinase, which results in the inhibition of the mammalian target of rapamycin protein. The encoded protein also plays a critical role in antioxidant defense by regenerating overoxidized peroxiredoxins, and the expression of this gene is a potential marker for exposure to radiation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SESN1 (ARP87808_P050) antibody |
| Blocking Peptide |
For anti-SESN1 (ARP87808_P050) antibody is Catalog # AAP87808 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human SESN1 |
| Uniprot ID |
Q9Y6P5-2 |
| Protein Name |
sestrin-1 |
| Protein Accession # |
NP_001186862.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001199933.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SESN1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human HepG2 Whole Cell
 | Host: Rabbit
Target Name: SESN1
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
