Search Antibody, Protein, and ELISA Kit Solutions

RXRA Antibody - C-terminal region (ARP33248_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33248_P050-FITC Conjugated

ARP33248_P050-HRP Conjugated

ARP33248_P050-Biotin Conjugated

Gene Symbol:
RXRA
Official Gene Full Name:
Retinoid X receptor, alpha
NCBI Gene Id:
6256
Protein Name:
Retinoic acid receptor RXR-alpha
Swissprot Id:
P19793
Protein Accession #:
NP_002948
Nucleotide Accession #:
NM_002957
Alias Symbols:
FLJ16020, FLJ16733, MGC102720, NR2B1
Replacement Item:
This antibody may replace item sc-111936 from Santa Cruz Biotechnology.
Description of Target:
Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription. RXRA is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators.Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription. The protein encoded by this gene is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
462
Molecular Weight:
51kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RXRA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RXRA.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human RXRA
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-RXRA (ARP33248_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PPARG; VDR; NCOA1; NSD1; UBC; NR1I3; NCOA4; THRB; THRA; ALOX15B; RARA; PPARA; CHD9; PRKD2; NR0B2; STAT1; NR3C2; SMAD2; GK; JAZF1; ACVR1B; NR1I2; NCOA2; PSMC5; RAD54L2; ARID5A; PML; SUMO1; ESR2; ESR1; BHLHE40; BHLHE41; NR4A1; EP300; NCOR1; NCOA6; NCOA3; TR
Blocking Peptide:
For anti-RXRA (ARP33248_P050) antibody is Catalog # AAP33248 (Previous Catalog # AAPP04285)
Datasheets/Manuals:
Printable datasheet for anti-RXRA (ARP33248_P050) antibody
Target Reference:
Lamhonwah,A.M., (2008) Mol. Cell. Biol. 28 (11), 3817-3829

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...