Search Antibody, Protein, and ELISA Kit Solutions

RP11-217H1.1 Antibody - N-terminal region (ARP58725_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58725_P050-FITC Conjugated

ARP58725_P050-HRP Conjugated

ARP58725_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Magnesium transporter 1
NCBI Gene Id:
Protein Name:
cDNA FLJ56344, highly similar to Implantation-associated protein EMBL BAG58019.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp564K142, FLJ14726, MAGT1, MGC64926, PRO0756, bA217H1.1, IAP, XMEN, MRX95, OST3B, RP11-217H1.1
Replacement Item:
This antibody may replace item sc-161814 from Santa Cruz Biotechnology.
Description of Target:
The specific function of this protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RP11-217H1.1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RP11-217H1.1.
The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-217H1.1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-RP11-217H1.1 (ARP58725_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MAGT1 (ARP58725_P050) antibody is Catalog # AAP58725 (Previous Catalog # AAPP36224)
Printable datasheet for anti-MAGT1 (ARP58725_P050) antibody
Sample Type Confirmation:

MAGT1 is supported by BioGPS gene expression data to be expressed in PANC1

Target Reference:
Shibatani,T., (2005) Biochemistry 44 (16), 5982-5992

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

122/05/2019 23:25
  • Overall Experience:
  • Quality:
HeLa and CHO-K1 cell lines in WB

Submitted by:
Natalia Cherepanova
University of Massachusetts Medical School


1. Sample type: HeLa and CHO-K1 cell lines. Control: Rough canine microsomes (cell organelles that must contain OST complexes)
Lane 1: 50ug HeLa cell lysate (Blocking: 1% Tween)
Lane 2: 50ug rough canine microsomes (Blocking: 1% Tween)
Lane 3: 50 ug CHO-K1 cell lysate (Blocking: 1% Tween)
Lane 4: 30ug rough canine microsomes (Blocking: 3% Milk)
Lane 5: 30ug HeLa cell lysate (Blocking: 3% Milk)

2. Sample preparation methods: Whole cell lysates were obtained using standard RIPA buffer (HeLa and CHO-K1), preparation of rough microsomes from canine pancreas is described in Kelleher DJ, Gilmore R. Proc Natl Acad Sci (1997) 94(10):4994-9 and Walter, P. & Blobel, G. (1983) Methods Enzymol. 96, 84–93. Canine Pancreatic Microsomal Membranes preps are identical to the commercially available canine rough microsomes from Promega.

3. Primary antibody dilution: 1:1000

4. Secondary antibody and dilution: Goat Anti-Rabbit IgG; 1:10000.

5. Protocol: Proteins were resolved by 13.5% SDS-PAGE and transferred to PVDF membranes. Membranes were washed with TBS for 10 min on a shacker. Memranes were blocked in 1% Tween TTBS for 30 min at 37C, and then were incubated with primary antibody (diluted in 1% Tween TTBS) at 4C overnight. After washing 3 times for 10 min with 1% Tween TTBS, the membranes were incubated in with secondary antibody for 1 hour, washed 3 times for 10 min with 1% Tween TTBs, and imaged on LAS-4000 instrument (Fujifilm Life Science) using LumiGlo chemiluminescent substrate system.
6. Would you use this antibody in future experiments? Yes.

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...