Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP58725_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58725_P050-FITC Conjugated

ARP58725_P050-HRP Conjugated

ARP58725_P050-Biotin Conjugated

RP11-217H1.1 Antibody - N-terminal region (ARP58725_P050)

Rating:
80% of 100
Catalog#: ARP58725_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-161814 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RP11-217H1.1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology dataAnti-RP11-217H1.1 (ARP58725_P050)
Peptide SequenceSynthetic peptide located within the following region: ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MAGT1 (ARP58725_P050) antibody is Catalog # AAP58725 (Previous Catalog # AAPP36224)
Datasheets/ManualsPrintable datasheet for anti-MAGT1 (ARP58725_P050) antibody
Sample Type Confirmation

MAGT1 is supported by BioGPS gene expression data to be expressed in PANC1

Target ReferenceShibatani,T., (2005) Biochemistry 44 (16), 5982-5992
Gene SymbolMAGT1
Official Gene Full NameMagnesium transporter 1
Alias SymbolsDKFZp564K142, FLJ14726, MAGT1, MGC64926, PRO0756, bA217H1.1, IAP, XMEN, MRX95, OST3B, RP11-217H1.1
NCBI Gene Id84061
Protein NamecDNA FLJ56344, highly similar to Implantation-associated protein EMBL BAG58019.1
Description of TargetThe specific function of this protein remains unknown.
Swissprot IdB4DH58
Protein Accession #NP_115497
Nucleotide Accession #NM_032121
Protein Size (# AA)367
Molecular Weight41kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express RP11-217H1.1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express RP11-217H1.1.
Protein InteractionsUBC; EED; RNF2; FBXO6; env; STT3B; RPL6; PPIB; LMNB1; DDOST;
Write Your Own Review
You're reviewing:RP11-217H1.1 Antibody - N-terminal region (ARP58725_P050)
Your Rating
Aviva Live Chat
Aviva Tissue Tool
Aviva HIS tag Deal
Aviva ChIP Antibodies