RP11-217H1.1 Antibody - N-terminal region (ARP58725_P050)

• Product Number: ARP58725_P050
• Name: RP11-217H1.1 Antibody - N-terminal region (ARP58725_P050)
• Protein Size (# AA): 367 amino acids
• Molecular Weight: 38 kDa
• NCBI Gene Id: 84061
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Magnesium transporter 1
• Alias Symbols: IAP, XMEN, MRX95, OST3B, CDG1CC, PRO0756, SLC58A1, bA217H1.1
• Peptide Sequence: Synthetic peptide located within the following region: ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Shibatani,T., (2005) Biochemistry 44 (16), 5982-5992
• Description of Target: The specific function of this protein remains unknown.
• Protein Interactions: UBC; EED; RNF2; FBXO6; env; STT3B; RPL6; PPIB; LMNB1; DDOST;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-MAGT1 (ARP58725_P050) antibody is Catalog # AAP58725 (Previous Catalog # AAPP36224)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-217H1.1
• Uniprot ID: B4DH58
• Protein Name: cDNA FLJ56344, highly similar to Implantation-associated protein EMBL BAG58019.1
• Sample Type Confirmation:

  MAGT1 is supported by BioGPS gene expression data to be expressed in PANC1

• Protein Accession #: NP_115497
• Purification: Affinity Purified
• Nucleotide Accession #: NM_032121
• Tested Species Reactivity: Human
• Gene Symbol: MAGT1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
• Image 1: Human PANC1
  
  Host: Rabbit
  Target Name: MAGT1
  Sample Type: PANC1
  Antibody Dilution: 1.0ug/mlMAGT1 is supported by BioGPS gene expression data to be expressed in PANC1