RHO Antibody - C-terminal region (ARP59909_P050)

Catalog No: ARP59909_P050

WB Suggested Anti-RHO Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RHO
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Sheep: 93%
• Peptide Sequence: Synthetic peptide located within the following region: AFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RHO (ARP59909_P050) antibody is Catalog # AAP59909 (Previous Catalog # AAPP46064)

Target Info

• Gene Symbol: RHO
• Gene Full Name: Rhodopsin
• Alias Symbols: RP4, OPN2, CSNBAD1
• NCBI Gene Id: 6010
• Protein Name: Rhodopsin
• Description of Target: Retinitis pigmentosa is an inherited progressive disease which is a major cause of blindness in western communities. It can be inherited as an autosomal dominant, autosomal recessive, or X-linked recessive disorder. In the autosomal dominant form,which comprises about 25% of total cases, approximately 30% of families have mutations in the gene encoding the rod photoreceptor-specific protein rhodopsin. This is the transmembrane protein which, when photoexcited, initiates the visual transduction cascade. Defects in this gene are also one of the causes of congenital stationary night blindness.
• Uniprot ID: P08100
• Protein Accession #: NP_000530
• Nucleotide Accession #: NM_000539
• Protein Size (# AA): 348
• Molecular Weight: 39kDa
• Protein Interactions: DERL1; EDEM1; VCP; UBC; HSPA4; DNAJB2; RHO; PPP2CA; GRK5; GRK6; ARR3; GNGT1; SAG; GRK1; PRKCA; ADRBK1;