Search Antibody, Protein, and ELISA Kit Solutions

PXDN Antibody - C-terminal region (ARP76716_P050)

100 ul
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Protein Name:
peroxidasin homolog
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
PXN, VPO, MG50, PRG2, COPOA, D2S448, D2S448E
Description of Target:
This gene encodes a heme-containing peroxidase that is secreted into the extracellular matrix. It is involved in extracellular matrix formation, and may function in the physiological and pathological fibrogenic response in fibrotic kidney. Mutations in this gene cause corneal opacification and other ocular anomalies, and also microphthalmia and anterior segment dysgenesis.
Protein Size (# AA):
Molecular Weight:
162 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PXDN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PXDN.
The immunogen is a synthetic peptide directed towards the C terminal region of human PXDN
Peptide Sequence:
Synthetic peptide located within the following region: VWQDCCEDCRTRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPRKIPSVG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PXDN (ARP76716_P050) antibody is Catalog # AAP76716
Printable datasheet for anti-PXDN (ARP76716_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...