| Product Number |
ARP76716_P050 |
| Product Page |
www.avivasysbio.com/pxdn-antibody-c-terminal-region-arp76716-p050.html |
| Name |
PXDN Antibody - C-terminal region (ARP76716_P050) |
| Protein Size (# AA) |
1479 amino acids |
| Molecular Weight |
162 kDa |
| NCBI Gene Id |
7837 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
peroxidasin |
| Alias Symbols |
PXN, VPO, MG50, PRG2, ASGD7, COPOA, D2S448, D2S448E |
| Peptide Sequence |
Synthetic peptide located within the following region: VWQDCCEDCRTRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPRKIPSVG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a heme-containing peroxidase that is secreted into the extracellular matrix. It is involved in extracellular matrix formation, and may function in the physiological and pathological fibrogenic response in fibrotic kidney. Mutations in this gene cause corneal opacification and other ocular anomalies, and also microphthalmia and anterior segment dysgenesis. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PXDN (ARP76716_P050) antibody |
| Blocking Peptide |
For anti-PXDN (ARP76716_P050) antibody is Catalog # AAP76716 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PXDN |
| Uniprot ID |
Q92626 |
| Protein Name |
peroxidasin homolog |
| Protein Accession # |
NP_036425.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_012293.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PXDN |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Leiomyosarcoma
 | Host: Rabbit
Target Name: PXDN
Sample Tissue: Human Leiomyosarcoma lysates
Antibody Dilution: 1ug/ml |
|
|
