Search Antibody, Protein, and ELISA Kit Solutions

PRMT2 Antibody - N-terminal region (ARP40195_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP40195_P050-FITC Conjugated

ARP40195_P050-HRP Conjugated

ARP40195_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-135010 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PRMT2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rat: 79%
Complete computational species homology data:
Anti-PRMT2 (ARP40195_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRMT2 (ARP40195_P050) antibody is Catalog # AAP40195 (Previous Catalog # AAPS01607)
Datasheets/Manuals:
Printable datasheet for anti-PRMT2 (ARP40195_P050) antibody
Sample Type Confirmation:

PRMT2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Meyer,R., J. Steroid Biochem. Mol. Biol. 107 (1-2), 1-14 (2007)
Publications:

Zhong, J. et al. Nuclear loss of protein arginine N-methyltransferase 2 in breast carcinoma is associated with tumor grade and overexpression of cyclin D1 protein. Oncogene. 33, 5546-58 (2014). WB, CHIP, Human, Rat 24292672

Gene Symbol:
PRMT2
Official Gene Full Name:
Protein arginine methyltransferase 2
Alias Symbols:
HRMT1L1, MGC111373
NCBI Gene Id:
3275
Protein Name:
Protein arginine N-methyltransferase 2
Description of Target:
The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.
Swissprot Id:
P55345
Protein Accession #:
NP_001526
Nucleotide Accession #:
NM_001535
Protein Size (# AA):
433
Molecular Weight:
49kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRMT2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRMT2.
Protein Interactions:
FIP1L1; SPAG8; RIPK2; BAG6; RB1; HNRNPA1; E2F1; UBC; PSMB3; HHV8GK18_gp81; CPSF7; DMRTB1; HNRNPUL1; PRMT2; THRB; PGR; NCOA6; NCOA1; ESR2; RXRA; PRRC2A; ESR1; PPARG; RARA;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...