Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40195_P050-FITC Conjugated

ARP40195_P050-HRP Conjugated

ARP40195_P050-Biotin Conjugated

PRMT2 Antibody - N-terminal region (ARP40195_P050)

Catalog#: ARP40195_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, CHIP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-135010 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PRMT2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%; Rat: 79%
Complete computational species homology data Anti-PRMT2 (ARP40195_P050)
Peptide Sequence Synthetic peptide located within the following region: ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PRMT2 (ARP40195_P050) antibody is Catalog # AAP40195 (Previous Catalog # AAPS01607)
Datasheets/Manuals Printable datasheet for anti-PRMT2 (ARP40195_P050) antibody
Sample Type Confirmation

PRMT2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference Meyer,R., J. Steroid Biochem. Mol. Biol. 107 (1-2), 1-14 (2007)

Zhong, J. et al. Nuclear loss of protein arginine N-methyltransferase 2 in breast carcinoma is associated with tumor grade and overexpression of cyclin D1 protein. Oncogene. 33, 5546-58 (2014). WB, CHIP, Human, Rat 24292672

Gene Symbol PRMT2
Official Gene Full Name Protein arginine methyltransferase 2
Alias Symbols HRMT1L1, MGC111373
NCBI Gene Id 3275
Protein Name Protein arginine N-methyltransferase 2
Description of Target The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.
Swissprot Id P55345
Protein Accession # NP_001526
Nucleotide Accession # NM_001535
Protein Size (# AA) 433
Molecular Weight 49kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PRMT2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PRMT2.
  1. What is the species homology for "PRMT2 Antibody - N-terminal region (ARP40195_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat".

  2. How long will it take to receive "PRMT2 Antibody - N-terminal region (ARP40195_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PRMT2 Antibody - N-terminal region (ARP40195_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "PRMT2 Antibody - N-terminal region (ARP40195_P050)"?

    This target may also be called "HRMT1L1, MGC111373" in publications.

  5. What is the shipping cost for "PRMT2 Antibody - N-terminal region (ARP40195_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRMT2 Antibody - N-terminal region (ARP40195_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRMT2 Antibody - N-terminal region (ARP40195_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRMT2 Antibody - N-terminal region (ARP40195_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PRMT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRMT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRMT2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRMT2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRMT2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRMT2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRMT2 Antibody - N-terminal region (ARP40195_P050)
Your Rating