Search Antibody, Protein, and ELISA Kit Solutions

Ppp3cb Antibody - C-terminal region : HRP (ARP57516_P050-HRP)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP57516_P050 Unconjugated

ARP57516_P050-FITC Conjugated

ARP57516_P050-Biotin Conjugated

Gene Symbol:
Ppp3cb
Official Gene Full Name:
Protein phosphatase 3, catalytic subunit, beta isoform
NCBI Gene Id:
19056
Protein Name:
Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
Swissprot Id:
P48453
Protein Accession #:
NP_032940
Nucleotide Accession #:
NM_008914
Alias Symbols:
1110063J16Rik, Calnb, CnAbeta, Cnab
Replacement Item:
This antibody may replace item sc-114729 from Santa Cruz Biotechnology.
Description of Target:
Ppp3cb is a Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.
Protein Size (# AA):
525
Molecular Weight:
58kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ppp3cb.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ppp3cb.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-Ppp3cb (ARP57516_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
CALM1; Ywhaz;
Blocking Peptide:
For anti-Ppp3cb (ARP57516_P050-HRP) antibody is Catalog # AAP57516 (Previous Catalog # AAPP41630)
Datasheets/Manuals:
Printable datasheet for anti-Ppp3cb (ARP57516_P050-HRP) antibody
Subunit:
beta isoform
Conjugation:
HRP

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...