Size:100 ul
$289.00
In Stock
SKU
ARP57516_P050-HRP
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP57516_P050 Unconjugated

ARP57516_P050-FITC Conjugated

ARP57516_P050-Biotin Conjugated

Ppp3cb Antibody - C-terminal region : HRP (ARP57516_P050-HRP)

Catalog#: ARP57516_P050-HRP
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-114729 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-Ppp3cb (ARP57516_P050)
Peptide Sequence Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI
Concentration 0.5 mg/ml
Blocking Peptide For anti-Ppp3cb (ARP57516_P050-HRP) antibody is Catalog # AAP57516 (Previous Catalog # AAPP41630)
Datasheets/Manuals Printable datasheet for anti-Ppp3cb (ARP57516_P050-HRP) antibody
Subunit beta isoform
Gene Symbol Ppp3cb
Official Gene Full Name Protein phosphatase 3, catalytic subunit, beta isoform
Alias Symbols 1110063J16Rik, Calnb, CnAbeta, Cnab
NCBI Gene Id 19056
Protein Name Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
Description of Target Ppp3cb is a Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.
Swissprot Id P48453
Protein Accession # NP_032940
Nucleotide Accession # NM_008914
Protein Size (# AA) 525
Molecular Weight 58kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Ppp3cb.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Ppp3cb.
Protein Interactions CALM1; Ywhaz;
  1. What is the species homology for "Ppp3cb Antibody - C-terminal region : HRP (ARP57516_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "Ppp3cb Antibody - C-terminal region : HRP (ARP57516_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Ppp3cb Antibody - C-terminal region : HRP (ARP57516_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Ppp3cb Antibody - C-terminal region : HRP (ARP57516_P050-HRP)"?

    This target may also be called "1110063J16Rik, Calnb, CnAbeta, Cnab" in publications.

  5. What is the shipping cost for "Ppp3cb Antibody - C-terminal region : HRP (ARP57516_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Ppp3cb Antibody - C-terminal region : HRP (ARP57516_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Ppp3cb Antibody - C-terminal region : HRP (ARP57516_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Ppp3cb Antibody - C-terminal region : HRP (ARP57516_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PPP3CB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PPP3CB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PPP3CB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PPP3CB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PPP3CB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PPP3CB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Ppp3cb Antibody - C-terminal region : HRP (ARP57516_P050-HRP)
Your Rating
We found other products you might like!