Search Antibody, Protein, and ELISA Kit Solutions

Ppp3cb Antibody - C-terminal region (ARP57516_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP57516_P050-FITC Conjugated

ARP57516_P050-HRP Conjugated

ARP57516_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-114729 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-Ppp3cb (ARP57516_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Ppp3cb (ARP57516_P050) antibody is Catalog # AAP57516 (Previous Catalog # AAPP41630)
Printable datasheet for anti-Ppp3cb (ARP57516_P050) antibody
beta isoform
Gene Symbol:
Official Gene Full Name:
Protein phosphatase 3, catalytic subunit, beta isoform
Alias Symbols:
1110063J16Rik, Calnb, CnAbeta, Cnab
NCBI Gene Id:
Protein Name:
Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
Description of Target:
Ppp3cb is a Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ppp3cb.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ppp3cb.
Protein Interactions:
CALM1; Ywhaz;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...