Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP32318_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32318_P050-FITC Conjugated

ARP32318_P050-HRP Conjugated

ARP32318_P050-Biotin Conjugated

POU1F1 Antibody - middle region (ARP32318_P050)

Catalog#: ARP32318_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human POU1F1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%; Sheep: 100%
Complete computational species homology data Anti-POU1F1 (ARP32318_P050)
Peptide Sequence Synthetic peptide located within the following region: KRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-POU1F1 (ARP32318_P050) antibody is Catalog # AAP32318 (Previous Catalog # AAPP03305)
Datasheets/Manuals Printable datasheet for anti-POU1F1 (ARP32318_P050) antibody
Target Reference Nakamura,T., (2008) Am. J. Hum. Genet. 82 (6), 1270-1280
Gene Symbol POU1F1
Official Gene Full Name POU class 1 homeobox 1
Alias Symbols GHF-1, PIT1, Pit-1, Pit-1 beta, CPHD1, POU1F1a
NCBI Gene Id 5449
Protein Name Pituitary-specific positive transcription factor 1
Description of Target PIT1 is a pituitary-specific transcription factor responsible for pituitary development and hormone expression in mammals and is a member of the POU family of transcription factors that regulate mammalian development. The POU family is so named because the first 3 members identified were PIT1 and OCT1 of mammals, and Unc-86 of C. elegans. PIT1 contains 2 protein domains, termed POU-specific and POU-homeo, which are both necessary for high affinity DNA binding on genes encoding growth hormone and prolactin. PIT1 is also important for regulation of the genes encoding prolactin and thyroid-stimulating hormone beta subunit by thyrotropin-releasing hormone and cyclic AMP. This gene encodes a member of the POU family of transcription factors that regulate mammalian development. The protein regulates expression of several genes involved in pituitary development and hormone expression. Mutations in this genes result in combined pituitary hormone deficiency. Multiple transcript variants encoding different isoforms have been found for this gene.
Swissprot Id P28069
Protein Accession # NP_000297
Nucleotide Accession # NM_000306
Protein Size (# AA) 291
Molecular Weight 33kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express POU1F1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express POU1F1.
Protein Interactions CEBPD; NCOR1; CREBBP; MED1; GATA2; NR1I3; NR1I2; PITX1; JUN; ETS1; NR3C1; VDR; PPARG; PPARA;
Write Your Own Review
You're reviewing:POU1F1 Antibody - middle region (ARP32318_P050)
Your Rating