Search Antibody, Protein, and ELISA Kit Solutions

POU1F1 Antibody - C-terminal region (ARP31419_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31419_P050-FITC Conjugated

ARP31419_P050-HRP Conjugated

ARP31419_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
The immunogen is a synthetic peptide directed towards the C terminal region of human POU1F1
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-POU1F1 (ARP31419_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-POU1F1 (ARP31419_P050) antibody is Catalog # AAP31419 (Previous Catalog # AAPP03105)
Printable datasheet for anti-POU1F1 (ARP31419_P050) antibody
Target Reference:
Dattani,M.T., et al., (2003) GrowthHorm.IGFRes.16(9),1207-1209

Tennant, D. A. & Gottlieb, E. HIF prolyl hydroxylase-3 mediates alpha-ketoglutarate-induced apoptosis and tumor suppression. J. Mol. Med. (Berl). 88, 839-49 (2010). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20383689

Gene Symbol:
Official Gene Full Name:
POU class 1 homeobox 1
Alias Symbols:
PIT1, CPHD1, GHF-1, Pit-1, POU1F1a
NCBI Gene Id:
Protein Name:
Pituitary-specific positive transcription factor 1
Description of Target:
PIT1 is a pituitary-specific transcription factor responsible for pituitary development and hormone expression in mammals and is a member of the POU family of transcription factors that regulate mammalian development. The POU family is so named because the first 3 members identified were PIT1 and OCT1 of mammals, and Unc-86 of C. elegans. PIT1 contains 2 protein domains, termed POU-specific and POU-homeo, which are both necessary for high affinity DNA binding on genes encoding growth hormone and prolactin. PIT1 is also important for regulation of the genes encoding prolactin and thyroid-stimulating hormone beta subunit by thyrotropin-releasing hormone and cyclic AMP.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express POU1F1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express POU1F1.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...