Search Antibody, Protein, and ELISA Kit Solutions

PIWIL4 Antibody - N-terminal region (ARP52961_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52961_P050-FITC Conjugated

ARP52961_P050-HRP Conjugated

ARP52961_P050-Biotin Conjugated

Gene Symbol:
PIWIL4
Official Gene Full Name:
Piwi-like 4 (Drosophila)
NCBI Gene Id:
143689
Protein Name:
Piwi-like protein 4
Swissprot Id:
Q7Z3Z4
Protein Accession #:
NP_689644
Nucleotide Accession #:
NM_152431
Alias Symbols:
DKFZp686P01248, FLJ36156, HIWI2, MIWI2
Replacement Item:
This antibody may replace item sc-517215 from Santa Cruz Biotechnology.
Description of Target:
PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.
Protein Size (# AA):
852
Molecular Weight:
96
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PIWIL4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PIWIL4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PIWIL4
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-PIWIL4 (ARP52961_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RELA; UBC; DICER1;
Blocking Peptide:
For anti-PIWIL4 (ARP52961_P050) antibody is Catalog # AAP52961 (Previous Catalog # AAPP35015)
Datasheets/Manuals:
Printable datasheet for anti-PIWIL4 (ARP52961_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...