| Product Number |
ARP52961_P050 |
| Product Page |
www.avivasysbio.com/piwil4-antibody-n-terminal-region-arp52961-p050.html |
| Name |
PIWIL4 Antibody - N-terminal region (ARP52961_P050) |
| Protein Size (# AA) |
852 amino acids |
| Molecular Weight |
96 |
| NCBI Gene Id |
143689 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Piwi-like 4 (Drosophila) |
| Alias Symbols |
HIWI2, MIWI2 |
| Peptide Sequence |
Synthetic peptide located within the following region: LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells. |
| Protein Interactions |
RELA; UBC; DICER1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PIWIL4 (ARP52961_P050) antibody |
| Blocking Peptide |
For anti-PIWIL4 (ARP52961_P050) antibody is Catalog # AAP52961 (Previous Catalog # AAPP35015) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PIWIL4 |
| Uniprot ID |
Q7Z3Z4 |
| Protein Name |
Piwi-like protein 4 |
| Protein Accession # |
NP_689644 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152431 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PIWIL4 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HT1080
 | WB Suggested Anti-PIWIL4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HT1080 cell lysate |
|
|
