Search Antibody, Protein, and ELISA Kit Solutions

PIGF Antibody - N-terminal region (ARP40408_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP40408_P050-FITC Conjugated

ARP40408_P050-HRP Conjugated

ARP40408_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-54306 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PIGF
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Horse: 92%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86%; Sheep: 86%
Complete computational species homology data:
Anti-PIGF (ARP40408_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PIGF (ARP40408_P050) antibody is Catalog # AAP40408 (Previous Catalog # AAPP22149)
Datasheets/Manuals:
Printable datasheet for anti-PIGF (ARP40408_P050) antibody
Target Reference:
Mohammed,K.A., Am. J. Physiol. Lung Cell Mol. Physiol. 292 (2), L559-L566 (2007)
Gene Symbol:
PIGF
Official Gene Full Name:
Phosphatidylinositol glycan anchor biosynthesis, class F
Alias Symbols:
MGC32646, MGC33136
NCBI Gene Id:
5281
Protein Name:
Phosphatidylinositol-glycan biosynthesis class F protein
Description of Target:
PIGF is a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. PIGF and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. This gene encodes a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. The encoded protein and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. Alternatively spliced transcript variants encoding different isoforms have been described.
Swissprot Id:
Q07326
Protein Accession #:
NP_002634
Nucleotide Accession #:
NM_002643
Protein Size (# AA):
219
Molecular Weight:
25kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PIGF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PIGF.
Protein Interactions:
PIGO; PIGG;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...