Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PIGF antibody - N-terminal region (ARP40408_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP40408_P050-FITC Conjugated

ARP40408_P050-HRP Conjugated

ARP40408_P050-Biotin Conjugated

Gene Symbol:
PIGF
NCBI Gene Id:
5281
Official Gene Full Name:
Phosphatidylinositol glycan anchor biosynthesis, class F
Protein Name:
Phosphatidylinositol-glycan biosynthesis class F protein
Swissprot Id:
Q07326
Protein Accession #:
NP_002634
Nucleotide Accession #:
NM_002643
Alias Symbols:
MGC32646, MGC33136
Replacement Item:
This antibody may replace item sc-54306 from Santa Cruz Biotechnology.
Description of Target:
PIGF is a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. PIGF and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. This gene encodes a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. The encoded protein and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Size (# AA):
219
Molecular Weight:
25kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PIGF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PIGF.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PIGF
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Horse: 92%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86%; Sheep: 86%
Complete computational species homology data:
Anti-PIGF (ARP40408_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PIGO; PIGG;
Blocking Peptide:
For anti-PIGF (ARP40408_P050) antibody is Catalog # AAP40408 (Previous Catalog # AAPP22149)
Datasheets/Manuals:
Printable datasheet for anti-PIGF (ARP40408_P050) antibody
Target Reference:
Mohammed,K.A., Am. J. Physiol. Lung Cell Mol. Physiol. 292 (2), L559-L566 (2007)

Tell us what you think about this item!

Write A Review
    Please, wait...