PIGF Antibody - N-terminal region (ARP40408_P050)

• Product Number: ARP40408_P050
• Name: PIGF Antibody - N-terminal region (ARP40408_P050)
• Protein Size (# AA): 219 amino acids
• Molecular Weight: 25kDa
• NCBI Gene Id: 5281
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Phosphatidylinositol glycan anchor biosynthesis, class F
• Alias Symbols: MGC32646, MGC33136
• Peptide Sequence: Synthetic peptide located within the following region: MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mohammed,K.A., Am. J. Physiol. Lung Cell Mol. Physiol. 292 (2), L559-L566 (2007)
• Description of Target: PIGF is a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. PIGF and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. This gene encodes a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. The encoded protein and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. Alternatively spliced transcript variants encoding different isoforms have been described.
• Protein Interactions: PIGO; PIGG;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PIGF (ARP40408_P050) antibody is Catalog # AAP40408 (Previous Catalog # AAPP22149)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIGF
• Uniprot ID: Q07326
• Protein Name: Phosphatidylinositol-glycan biosynthesis class F protein
• Protein Accession #: NP_002634
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002643
• Tested Species Reactivity: Human
• Gene Symbol: PIGF
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Horse: 92%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86%; Sheep: 86%
• Image 1: Human 786-0 Whole Cell
  
  Host: Rabbit
  Target Name: PIGF
  Sample Tissue: Human 786-0 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 2: Human Bronchial Epithelial Tissue
  
  PIGF antibody - N-terminal region (ARP40408_P050)
  Catalog Number: ARP40408_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
  Observed Staining: Cytoplasm in Human Bronchial Epithelial Tissue
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 3: Human Jurkat
  
  WB Suggested Anti-PIGF Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate