Search Antibody, Protein, and ELISA Kit Solutions

NFATC3 Antibody - N-terminal region (P100975_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100975_P050-FITC Conjugated

P100975_P050-HRP Conjugated

P100975_P050-Biotin Conjugated

Gene Symbol:
NFATC3
Official Gene Full Name:
Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
NCBI Gene Id:
4775
Protein Name:
Nuclear factor of activated T-cells c3 isoform IB-Xa EMBL ACG55625.1
Swissprot Id:
B5B2S0
Protein Accession #:
NP_004546
Nucleotide Accession #:
NM_004555
Alias Symbols:
NFAT4, NFATX
Replacement Item:
This antibody may replace item sc-1149 from Santa Cruz Biotechnology.
Description of Target:
NFATC3 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. NFATC3 plays a role in the regulation of gene expression in T cells and immature thymocytes.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Four transcript variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
1068
Molecular Weight:
115kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NFATC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NFATC3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC3
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rat
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 92%
Complete computational species homology data:
Anti-NFATC3 (P100975_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MAPK9; MAPK8; CDK6; NCOA3; TTF1; CSNK1A1; FOS;
Blocking Peptide:
For anti-NFATC3 (P100975_P050) antibody is Catalog # AAP31016 (Previous Catalog # AAPP01749)
Datasheets/Manuals:
Printable datasheet for anti-NFATC3 (P100975_P050) antibody
Target Reference:
Manley,K., (2006) J. Virol. 80 (24), 12079-12085

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...