| Product Number |
P100975_P050 |
| Product Page |
www.avivasysbio.com/nfatc3-antibody-n-terminal-region-p100975-p050.html |
| Name |
NFATC3 Antibody - N-terminal region (P100975_P050) |
| Protein Size (# AA) |
1068 amino acids |
| Molecular Weight |
115kDa |
| NCBI Gene Id |
4775 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 |
| Description |
|
| Alias Symbols |
NFAT4, NFATX, NF-AT4c |
| Peptide Sequence |
Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Manley,K., (2006) J. Virol. 80 (24), 12079-12085 |
| Description of Target |
NFATC3 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. NFATC3 plays a role in the regulation of gene expression in T cells and immature thymocytes.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Four transcript variants encoding distinct isoforms have been identified for this gene. |
| Protein Interactions |
MAPK9; MAPK8; CDK6; NCOA3; TTF1; CSNK1A1; FOS; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NFATC3 (P100975_P050) antibody |
| Blocking Peptide |
For anti-NFATC3 (P100975_P050) antibody is Catalog # AAP31016 (Previous Catalog # AAPP01749) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC3 |
| Uniprot ID |
B5B2S0 |
| Protein Name |
Nuclear factor of activated T-cells c3 isoform IB-Xa EMBL ACG55625.1 |
| Protein Accession # |
NP_004546 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004555 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
NFATC3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 92% |
| Image 1 | Human HeLa
 | WB Suggested Anti-NFATC3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate |
|
| Image 2 | Human Thymus
 | Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-NFATC3 antibody (P100975_P050) |
|
| Image 3 | Human Fetal Lung
 | Host: Rabbit
Target Name: NFATC3
Sample Type: Fetal Lung lysates
Antibody Dilution: 1.0ug/ml |
|
| Image 4 | Human Lung
 | Rabbit Anti-NFATC3 Antibody
Catalog Number: P100975
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 5 | Mouse Pancreas
 | Host: Mouse
Target Name: NFATC3
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml |
|
| Image 6 | Mouse Testis
 | Host: Mouse
Target Name: NFATC3
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml |
|
