Search Antibody, Protein, and ELISA Kit Solutions

NARG1 Antibody - N-terminal region (ARP48989_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48989_P050-FITC Conjugated

ARP48989_P050-HRP Conjugated

ARP48989_P050-Biotin Conjugated

Gene Symbol:
NAA15
Official Gene Full Name:
N(alpha)-acetyltransferase 15, NatA auxiliary subunit
NCBI Gene Id:
80155
Protein Name:
N-alpha-acetyltransferase 15, NatA auxiliary subunit
Swissprot Id:
Q9BXJ9
Protein Accession #:
NP_476516
Nucleotide Accession #:
NM_057175
Alias Symbols:
Ga19, NATH, TBDN100, NARG1
Replacement Item:
This antibody may replace item sc-135158 from Santa Cruz Biotechnology.
Description of Target:
The ARD1A-NARG1 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. NARG1 is required to control retinal neovascularization in adult ocular endothelial cells. In complex with G22P1 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
866
Molecular Weight:
101kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NARG1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NARG1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NARG1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-NARG1 (ARP48989_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSEL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; SUMO2; NAA50; DDI2; HYPK; VPS26A; NAA10; TSNAX; STAT1; VCAM1; ITGA4; FN1; ASUN; MATR3; SIRT7; RAD21; Naa15; XRCC5; XRCC6; UBA5; NAA11;
Blocking Peptide:
For anti-NAA15 (ARP48989_P050) antibody is Catalog # AAP48989 (Previous Catalog # AAPY02135)
Datasheets/Manuals:
Printable datasheet for anti-NAA15 (ARP48989_P050) antibody
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...