Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48989_P050-FITC Conjugated

ARP48989_P050-HRP Conjugated

ARP48989_P050-Biotin Conjugated

NARG1 Antibody - N-terminal region (ARP48989_P050)

Catalog#: ARP48989_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-135158 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human NARG1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-NARG1 (ARP48989_P050)
Peptide SequenceSynthetic peptide located within the following region: LRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSEL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-NAA15 (ARP48989_P050) antibody is Catalog # AAP48989 (Previous Catalog # AAPY02135)
Datasheets/ManualsPrintable datasheet for anti-NAA15 (ARP48989_P050) antibody
Target ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Gene SymbolNAA15
Official Gene Full NameN(alpha)-acetyltransferase 15, NatA auxiliary subunit
Alias SymbolsGa19, NATH, TBDN100, NARG1
NCBI Gene Id80155
Protein NameN-alpha-acetyltransferase 15, NatA auxiliary subunit
Description of TargetThe ARD1A-NARG1 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. NARG1 is required to control retinal neovascularization in adult ocular endothelial cells. In complex with G22P1 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdQ9BXJ9
Protein Accession #NP_476516
Nucleotide Accession #NM_057175
Protein Size (# AA)866
Molecular Weight101kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express NARG1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express NARG1.
Protein InteractionsUBC; SUMO2; NAA50; DDI2; HYPK; VPS26A; NAA10; TSNAX; STAT1; VCAM1; ITGA4; FN1; ASUN; MATR3; SIRT7; RAD21; Naa15; XRCC5; XRCC6; UBA5; NAA11;
Write Your Own Review
You're reviewing:NARG1 Antibody - N-terminal region (ARP48989_P050)
Your Rating
Aviva Tips and Tricks
Aviva Travel Grant
Aviva Live Chat
Aviva Blast Tool